1. Bahwa gerak hanyalah ilusi dan waktu hanyalah sebuah konsep…..
2. Sel2x tubuh manusia menyelesaikan regenerasinya yang baru setiap 72 jam…..
3. Islandia itu berwarna hijau dan Greenland tertutup dengan es…..
4. Lempeng bumi bergerak 0,007 Cm setiap harinya……
5. Rata2x orang di Amerika memiliki 2 kartu kredit dan dijepang rata2x setiap orang memiliki 5 kartu kredit……
6. Dalam 4.000 thn terakhir ini hanya Sapi yang tidak mengalami perubahan genetik……
7. Tulisan Cina untuk “MASALAH” adalah gambar 2 wanita tinggal diatap rumah yang sama.
8. Tulisan Cina untuk “KRISIS” dan “KESEMPATAN” adalah sama.
9. Zaire adalah penghasil Cobalt terbesar didunia, 2/3 produksi cobalt dihasilkan di Zaire.
10. “IBM COMPATIBLE” tidak 100 % compatible kecuali dia dapat menjalankan MIRCOSOFT FLIGHT SIMULATOR.
11. Semua Angsa di Inggris adalah Properti dari Ratu dan mengangu mereka merupakan sebuah pelanggaran berat dengan sanksi hukuman penjara.
12. Leonardo Da Vinci yang menciptakan gunting modern.
13. Mark Twain lahir dihari dimana komet halley melintas dan dia meninggal 76 thn berikutnya tepat dihari dimana komet halley melintas lagi.
14. Hard Drive pertama yang diciptakan memiliki kapasitas terbesar adalah 5 MB dan berharga $ 45.000
15. Pada versi originalnya, Cerita 1001 satu malam dimulai dengan “Alladin seorang bocah cina….”
16. Menurut survei unesco thn 1996, nama yang paling umum dipakai didunia adalah Mohammed.
17. Kata2x “Set” adalah kata2x yang memiliki arti paling banyak didalam kamus bahasa inggris keluaran Oxford.
18. Ikan dari Capt.Jean Luc Picard bernama Livingston dan Kucing dari Lt.Data bernama Spot.
19. Gas Hydrogen adalah unsur yang paling ringan yang ada didunia ini yaitu 0.08988 g/cc dan hidrogen padat adalah yang terberat didunia ini yaitu 70.6 g/cc.
20. Singapore adalah satu2xnya negara dengan 1 stasiun kereta api.
21. Leeuwarden, sebuah kota dibelanda dapat di lafalkan dengan 255 cara berbeda.
22. Kata2x yang tertua dan tidak berubah maknanya dalam bahasa inggris adalah “TOWN”
23. Nama2x benua didunia selalu diawali dan diakhiri oleh hurup yang sama dalam bahasa inggris.
24. Menurut teori relativitas einstein bahwa dimungkinan untuk bergerak lebih lambat atau lebih cepat daripada kecepatan cahaya tetapi tidak mungkin dapat bergerak sama dengan kecepatan cahaya.
25. Nama tengah dari Donald Duck adalah Fintleroy.
26. Bill Gates di Gaji 1 $ setiap bulannya untuk berkerja di Microsoft.
27. 10 tahun lalu wanita di dunia rata2 ukuran itunya 36B, sekarang sudah 36C
28. Kembang api, roket, argometer ditemukan oleh org cina yang secara prinsipil sampe skrg ngga berubah
29. Kebanyakan orang secara tidak sadar lebih sering bebelok kesebelah kanan dibanding kesebelah kiri ketika berjalan.
30. Lebih banyak orang yang meninggal akibat tersedak dibandingkan mereka yang meninggal karena penyakit jantung koroner.
31. Kemungkinan orang tersambar petir digurun Nevada lebih besar dibandingkan dengan memenangkan lotto jackpot.
32. Seekora capung hanya memiliki rata2x waktu hidup 24 jam saja. Dan seekor ikan mas hanya memiliki 3 detik saja ingatan diotaknya.
33. Pada sebuah pertandingan antara Liverpool dan Chester City dithn 68 yang berakhir dengan skor 2-2, ke 4 Gol itu diciptakan oleh orang yang sama.
34. Pertandingan dengan penalti terburuk adalah antara Steau bucharest dan barcelona pada Piala champion thn 85/86. dari 10 tendangan, 8 berhasil ditahan kiper dan 2 berhasil pada putaran ke 3 penalti (Artinya 20 penalti sebelumnya tidak ada satupun yang masuk kegawang)
35. Nama terpanjang di dunia itu datangnya dr Thailand yaitu: “Krungthepmahanakonbowornratanakosinmahintaray udya y amahadiloponoparatanarajthaniburiromudomrajniwesma hasatarnamornpimarnavatarsatitsakattiyavisanukamph rasit” The translation here is pretty much the unabridged history of the city rather than a word: krungthep mahanakhon = The land of angels, the great city of; amorn rattanakosin = immortality, various of devine gems; mahintara yudthaya mahadilok pohp = the great angelic land unconquerable; noparat rajathanee bureerom = land of nine noble gems, the royal city, the pleasant capital; udomrajniwes mahasatarn = place of the grand royal palace; amorn pimarn avaltarnsatit = forever land of angels and reincarnated spirits; sakatattiya visanukram prasit = predestined and created by the highest devas.
36. 99% manusia tidak dapat menjilati sikunya sendiri.
37. 90% orang yang telah membaca kalimat di atas akan mencoba menjilati sikunya sendiri.
38. Kecoa itu dapat bertahan dari radiasi nuklir
39. Kucing kampung mendengkur setiap 26 kali per detik, sama dengan frekwensi mesin disel dalam keadaan idle. Kucing kampung dapat mendengar frekswensi suara hingga 65 kHz, sedangkan manusia hingga 20 kHz. Kemampuan indera penciumannya 14 kali lebih kuat daripada penciuman manusia.
40. Kucing kampung – atau jenis kucing apapun juga – tidak mempunyai 9 nyawa cadangan. Mereka juga tidak selalu mendarat dengan ujung kakiknya. Dikatakan bahwa seekor kucing yang jatuh dari tingkat 20 mempunyai kemungkinan selamat lebih besar dibanding dengan yang jatuh dari tingkat 7, karena seekor kucing membutuhkan ketinggian sekurangnya 7 lantai untuk dapat mengatur tubuhnya agar dapat mendarat dengan kakinya.
41. Kucing melangkah dengan kedua kaki kirinya, sedangkan pada saat berlari menggunakan kedua kaki kanannya. Satu-satunya binatang yang melakukan hal ini adalah jerapah dan onta.
42. Jantung kita berdenyut rata2 100,000 denyutan/hari
43. Rata2 manusia mengedipkan mata adalah 6,205,000 setiap tahunnya
44. Disaat seseorang bersin,dapat mencapai kecepatan 100 m.p.h
45. Bagian tubuh yg akan selalu tumbuh adalah kuping dan hidung
46. Gigi adalah satu2nya bagian tubuh yg tidak bisa memperbaiki dengan sendirinya.
47. Detak jantung ****** antara 70-120 permenit sedangkan manusia hanya sekitar 70-80 permenit.
48. Kebanyakan ****** hanya mampu berlari dengan kecepatan 30,5 km/jam sedangkan ****** trah Greyhound dapat berlari dengan kecepatan 64 km/jam. Pantas saja kalau trah ini disebut dengan rajanya ****** pelari.
49. ****** dengan ukuran terbesar adalah Irish Wolfhound.
50. ****** dengan ukuran tubuh terkecil adalah Chihuahua, sementara untuk ukuran berat badan terberat adalah Saint Bernard.
51. ****** terkecil yang pernah tercatat dalam sejarah adalah seekor Yorkshire Terrier yang berasal dari Blackburn (Inggris). Pada saat berumur 2 tahun hanya memiliki tinggi tubuh 6,35 cm, panjang tubuh 9,5 cm dan berat tubuh 113 gram!!!
52. ****** yang pernah hidup paling lama yang tercatat dalam sejarah adalah seekor ****** Australian cattle-dog yang bernama Bluey. Bluey di‰tidurkan‰ pada usia 29 tahun dan 5 bulan !!!

53. ****** terberat dan terpanjang yang pernah tercatat sepanjang sejarah adalah Old English Mastiff yang bernama Zorba. Dia memiliki bobot badan 155 kg dan memiliki panjang 3,1 meter diukur dari ujung hidung sampai ujung ekor.
54. ****** dengan ukuran tertinggi yang pernah tercatat dalam sejarah adalah ****** trah Great Dane dengan nama Shamgret Danzas. Dia memiliki tinggi 1,06 meter yang diukur dari pundak dan memiliki berat tubuh 108 kg.
55.****** trah Dalmatian tidak lahir dengan totol-totol hitamnya. Ketika lahir mereka hanya memiliki warna putih saja pada bulu mereka. Setelah dua minggu totol hitamnya baru akan muncul.
56. Ada persamaan antara ****** dan burung jika memberikan makan pada anak-anakanya yang masih belum bisa mencari makan sendiri. Setelah makan kenyang, ****** akan menghampiri sarangnya dan akan memuntahkan sebagian isi perutnya untuk dimakan oleh anak-anak mereka.
57.Sendawa pertama yang pernah tersiarkan secara nasional adalah di tahun 1935.
58. Tikus ML cuma bertahan 5 detik !!!
59. Dibutuhkan kulit dari 3000 sapi untuk bikin bola football bermerk NFL per tahunnya
60. Presiden Benjamin Harrison ternyata takut untuk menyentuh saklar
61. Kalo para cowo Jepang mo bikin sumpah, mereka kencing bareng dan saling menyilangkan air kencingnya yang memancur
62. Ternyata ada 170,000,000,000,000,000,000,000,000 jalan yang bisa dimainkan pada 10 langkah awal dalam sebuah permainan catur
63. Ternyata juga, Walt Disney itu takut lho sama tikus
64. 85% telfon bertemakan cabul dilakukan oleh PRIA
65. Kuku manusia terbuat dari bahan yang sama dengan bahan pada paruh burung
66. Piala Oscar yang diberikan pada masa Perang Dunia II ternyata terbuat dari plester/plastik karena saat itu logam sangat langka
67. Manusia tertua yang pernah tercatat (dalam Guinness Book of World Records) adalah Jeanne Louise Calment, seorang wanita berkebangsaan Prancis. Ia lahir pada tanggal 21 Februari 1875 dan meninggal pada tanggal 4 Agustus 1997 dalam umur 122 tahun 164 hari
68. Kemudian, tahukah kamu? Bahwa dia itu seorang perokok dan baru berhenti merokok saat berumur 117 tahun.
69. Negara Republik Siprus memiliki lagu kebangsaan yang sama dengan lagu kebangsaan Yunani.
70. Lagu kebangsaan yang berjudul “Imnos is tin Eleftherian” itu merupakan lagu kebangsaan terpanjang di dunia, yang terdiri atas 158 bait, dan setiap bait terdapat 8 baris.
71. Lagu kebangsaan negara Liechenstein, yaitu “Oben am jungen Rhein” mempunyani nada yang sama persis dengan lagu kebangsaan Inggris, “God Save the Queen”.
72. Amerika Serikat adalah negara yang paling banyak/sering mengganti desain bendera nasionalnya. Sejak merdeka Amerika Serikat telah mengganti desain benderanya sebanyak 26 kali, terakhir kali dilakukan pada 4 Juli 1960.
73.Warna yang paling banyak digunakan dalam bendera-bendera negara adalah warna merah, dan simbol yang paling banyak dipakai adalah simbol bintang.
74. Bagian belakang bendera Paraguay mempunyai simbol yang berbeda dengan bagian depannya.
75. Mata uang tertinggi di dunia adalah Kuwait Dinar (KWD), dengan nilai:
1 KWD = 3,40 USD = 31.170,00 IDR
76. Mata uang terndah di dunia adalah Zimbabwe Dollar (ZWD), dengan nilai:
1 USD = 99.200,00 ZWD
1 IDR = 10,80 ZWD
77. Indonesia Rupiah (IDR) adalah mata uang terendah ke-5 di dunia
78. Kamu nggak pernah bisa mengikat tali sepatu sama kencangnya antara tali sepatu kiri dan tali sepatu kanan
79. Pulau Jawa adalah pulau dengan penduduk terbanyak sekaligus terpadat di dunia. Jumlah penduduknya 127.000.000 jiwa dan kepadatan penduduknya 962 jiwa/km2.
80. Rotasi Planet Venus sangat lambat sehingga periode rotasinya lebih lama dibandingkan periode revolusinya. Tidak seperti planet pada umumnya, rotasi Planet Venus bergerak dari arah timur ke barat, sehingga JIKA kamu berada di Venus, kamu akan melihat matahari terbit di sebelah barat dan terbenam di sebelah timur.
81. Nama tempat paling panjang di Bumi yang diketahui adalah :
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysilio gogogoch
Terletak di barat laut Wales, United Kingdom. Tetapi kebanyakan orang sering memanggilnya secara mudah sebagai Llanfair PG
82. Dalam keaadan berbaring daya kreativitas lebih tinggi (dibanding duduk) ? dlm keadaan duduk terjadi tekanan darah yg lbh tinggi pada bagian kepala, leher, punggung. hal ini menyebabkan reseptor tekanan dlm dinding pembuluh darah aktiv, yg berakibat daya guna otak menurun & ketegangan.
83. San francisco adl kota dengan homo seksual ter tinggi. 40% lakinya tukang sodok belakang (alias maen anggar)
84. Sebuah bola baseball memiliki tepat 108 jahitan, sebuah bola untuk sepakbola memiliki 642 jahitan
85. Dimanakah tempat terpanas di bumi ? Di El Azizia di Libya.
Suhunya pernah mencapai 57.8 Celcius pada bulan September 1922.
86. Dimanakah tempat terdingin di bumi ? Di Vostok, Antartika.
Suhunya pernah mencapai -89 Celsius pada bulan Juli 1983.
87. Lampu lalu lintas pertama kali ada di persimpangan London tahun 1868, berisi gas yang diselubungi kurungan warna merah dan hijau. Kemudian pada tahun 1920 ada yang lebih modern diciptakan oleh Garrett Augustus Morgan di Detroit Amerika Serikat untuk signal kereta api yang selanjutnya ia patenkan dan kita gunakan hingga kini.
88. Merokok dapat mengurangi massa tulang, terganggunya system hormonal terutama Estrogen pada Wanita sehingga menyebabkan Menopause dini .
89. Ternyata dari hasil penelitian bahwa makan terlalu banyak Protein dan garam dapat mengakibatkan penipisan kalsium pada tulang.
90Kopi, teh, minuman soda ternyata dapat menyebabkan tubuh kehilangan banyak kandungan kalsium di bandingkan dengan orang – orang yang jarang minum kopi ,teh atau minuman soda…!?
91. Ketika baru lahir, kamu hanya memiliki 300 tulang. Seiring dengan bertambah besar, beberapa dari tulang ini mulai menyatu. Hasilnya? Orang dewasa memiliki hanya 206 tulang.
92. Tahukah kamu bahwa manusia dan jerapah memiliki jumlah tulang yang sama di lehernya? Sementara leher mereka jauh lebih panjang dari kita, yah?
93. 96 persen mahluk hidup di Bumi tidak memiliki tulang belakang. Tapi mereka yang memiliki tulang belakang memiliki banyak persamaan: tengkorak yang mengelilingi otak, tulang rusuk untuk melindungi jantung dan tulang rahang atau tulang mulut.
94. Kalsium adalah sahabat terbaik tulang. Karena itu, banyak-banyaklah mengonsumsi makanan yang mengandung kalsium. Seperti susu. Sehingga tulangmu tetap sehat dan kuat
95. Obat yang dianggap sebagai obat dewa yaitu kortison ternyata dapat menyebabkan keropos tulang atau yang dikenal dengan Osteoporosis dan memperlambat pertumbuhan tulang.
96. Tahukah kamu bahwa lidah kita mempunyai kurang lebih 10.000 indra perasa untuk mencicipi masakan yang sedaaap ….!!
97. Kebiasaan minum Alkohol sangat tidak ada faedahnya, karena dapat menjadi ketagihan , merusak sel Hati / lever sehingga dapat menyebabkan sirosis Hati dan juga osteoporosis dini
98. Saat ini juga di otak anda sedang terjadi jutaan reaksi kimia yang berbeda.
99. Deja vu bukanlah mengingat kembali kejadian yang pernah terjadi melainkan terjadinya kerusakan sementara beberapa sel yang menyebabkan anda merasa mengingat kembali suatu yang tak pernah terjadi sebelumnya